PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 356aa    MW: 40289.4 Da    PI: 4.7083
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608942.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK69.35.5e-22265314352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      +++l+d + y +lpi+ AAk+L++c+Tv+K+ CR+ G+ RWP+Rkiks+
  XP_009608942.1 265 GKLRLKDFAGYLHLPIEIAAKKLNICPTVMKKVCRRDGLLRWPYRKIKSI 314
                     68999*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.483254334IPR003035RWP-RK domain
PfamPF020422.9E-19267314IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDYPTAIVPY HDPFDDSCSI GQISLFDENP TIGLPKSAWN QEPFTFDPTI LKSDNDFGVY  60
DPFDDPILLD IPYECNDYLV ENSTNTEAGV QDGVFENKSH VSVWPVSSST SMCTNNCQIL  120
REITHSNGLQ ISKLNIYGTL GRISHAVLEK YTSDFSSQSH ESPQIFDFSK DSTSSVKQFL  180
VQYFEACKLE GYILLQDPLC DFYEALGVGS DDGDILDIDS LLQLSPTISR DCQMNQQEMK  240
NESEANCNDM RHEKIPLSAQ RERTGKLRLK DFAGYLHLPI EIAAKKLNIC PTVMKKVCRR  300
DGLLRWPYRK IKSIKRKISK REKSLSSSDV EERASAKAEI AKLEEELAKN FEAFVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608942.10.0PREDICTED: uncharacterized protein LOC104102813
TrEMBLK4CL093e-92K4CL09_SOLLC; Uncharacterized protein
STRINGSolyc08g062200.1.19e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35052027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.13e-07Nin-like family protein